Glucagon (1-29)-[Lys(AF647)]

HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys(AF647 DBCO)]-amide

  • Description

  • Application Data

Description

Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. This peptide contains AF647, which is a widely used far-red fluorescent dye.

See full description

Application Data

Catalogue number crb1101573
Molecular Weight 4750.0
Sequence (one letter code)

HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys(AF647 DBCO)]-amide

Sequence (three letter code)

H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Lys(AF647 DBCO)]-NH2

Purity >95%
Storage -20°C
References

Hughes et al., (2018). Regulation of islet glucagon secretion: Beyond calcium. Diabetes Obes Metab., 20(2): 127. PMID: 30230183.

Katahira et al., (2019). Postprandial plasma glucagon kinetics in type 2 diabetes mellitus: comparison of immunoassay and mass spectrometry. J. Endocrinol., 3(1): 42. doi: 10.1210/js.2018-00142.

Manufactured in: United Kingdom
Data Sheet Material Safety Data Sheet (MSDS)

Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.

This peptide contains AF647, structural analog to Alexa Fluor® 647 which is a widely used far-red fluorescent dye.

Glucagon (1-29)-[Lys(AF647)]

Cat No.Pack SizePriceQty.
0.1mg£170.00
0.5mg£220.00
Bulk Quote