Glucagon (1-29)-[Cys(Cy5)]
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Cys(Cy5)]-acid
Description
Application Data
Description
-
Glucagon (1-29)-[Cys(Cy5)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. This peptide contains Cyanine 5 (Cy5), which is a widely used red fluorescent dye.
Application Data
-
Data Sheet Material Safety Data Sheet (MSDS)Catalogue number crb1130431 Molecular Weight 4189 Sequence (one letter code) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Cys(Cy5)]-acid
Sequence (three letter code) H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Cys(Cy5)]-OH
Purity >95% Storage -20°C References Hughes et al., (2018). Regulation of islet glucagon secretion: Beyond calcium. Diabetes Obes Metab., 20(2): 127. PMID: 30230183.
Katahira et al., (2019). Postprandial plasma glucagon kinetics in type 2 diabetes mellitus: comparison of immunoassay and mass spectrometry. J. Endocrinol., 3(1): 42. doi: 10.1210/js.2018-00142.
Manufactured in: United Kingdom Glucagon (1-29)-[Cys(Cy5)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.
This peptide contains Cyanine 5 (Cy5), which is a widely used red fluorescent dye.