Glucagon (1-29)-[Cys(Cy5)] 0.1mg HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Cys(Cy5)]-acid

£190.00
  • Description

  • Application Data

Description

Glucagon (1-29)-[Cys(Cy5)]

See full description

Application Data

Catalogue number crb1130431f
Molecular Weight 4189
Sequence (one letter code) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Cys(Cy5)]-acid
Sequence (three letter code)

H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Cys(Cy5)]-OH

Purity >95%
Storage -20°C
Manufactured in: United Kingdom
Data Sheet Material Safety Data Sheet (MSDS)

Glucagon (1-29)-[Cys(Cy5)]

Glucagon (1-29)-[Cys(Cy5)] 0.1mg

0.1mg
Bulk Quote