Glucagon like-peptide-2 (GLP-2)
DGSFSDEMNTILDNLAARDFINWLIQTKITD-acid
Description
Application Data
Description
-
Glucagon like-peptide-2 (GLP-2) is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule.
Application Data
-
Catalogue number crb1001638 Molecular Weight 3555.7 Sequence (one letter code) DGSFSDEMNTILDNLAARDFINWLIQTKITD-acid
Sequence (three letter code) H-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Purity >95% Storage -20°C References Jeppesen (2012) Teduglutide, a novel glucagon-like peptide 2 analog, in the treatment of patients with short bowel syndrome. Ther. Adv. Gastroenterol. 5(3) 159 PMID: 22570676
Schwartz et al (2016) Long-Term Teduglutide for the Treatment of Patients With Intestinal Failure Associated With Short Bowel Syndrome. Clin.Transl. Gastroenterol. 7(2) e142 PMID: 26844839
Manufactured in: United Kingdom Glucagon like-peptide-2 (GLP-2) is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects; promoting the expansion of the intestinal mucosa; stimulating intestinal blood flow; inhibiting gastric acid secretion and gastric emptying; increasing intestinal barrier function and enhancing nutrient and fluid absorption.
You may also like…
-
[5-FAM]-GLP-1 (7-36)
[5-FAM]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products -
GLP-1 (7-36) [Cys(Sulfocyanine5)]
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide
View products -
Biotin-GLP-1 (7-36)
[Biotin]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products -
GLP-1 (1-37)
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-acid
View products -
[Biotin]-GLP-1
[Biotin]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIA-W-LVKGR-amide
View products -
GLP-1 (9-36) amide
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products -
Liraglutide
HAEGTFTSDVSSYLEGQAA-[Lys([Palm]-[g-Glu]-)]-EFIAWLVRGRG-acid
View products -
GLP (7-36) Heavy
HAEGT-[U-13C9,15N-Phe]-TSD-V-SSY-[U-13C6,15N-LEU]-EGQAAKEFIA-W-[U-13C6,15N-LEU]-VKGR-amide
View products -
Oxyntomodulin Heavy
HSQGTFTSDYSKY-[U-13C6,15N-Leu]-DSRRAQD-[U-13C9,15N-Phe]-VQW-[U-13C6,15N-Leu]-MNTKRNRNNIA-acid
View products -
Teduglutide (GLP2 2G)
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-acid
View products -
[5-FAM]-GLP-1
[5-FAM]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products