GLP-1 (7-36) [Cys(Sulfocyanine5)] 0.1mg HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide

£260.00
  • Description

  • Application Data

Description

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide]

See full description

Application Data

Catalogue number crb1100802f
Molecular Weight 4162.9
Sequence (one letter code) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide
Sequence (three letter code)

H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-[Cys(Sulfocyanine5)]-NH2

Purity >95%
Manufactured in: United Kingdom
Data Sheet Material Safety Data Sheet (MSDS)

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide]

GLP-1 (7-36) [Cys(Sulfocyanine5)] 0.1mg

0.1mg
Bulk Quote