GIP (1-42)-[C] human 0.1mg YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-[C]-amide

£130.00
  • Description

  • Application Data

Description

GIP (1-42)-[C] human

See full description

Application Data

Catalogue number crb1000509f
Molecular Weight 5082.5
Sequence (one letter code) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-[C]-amide
Sequence (three letter code)

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-Cys-NH2

Purity >95%
Storage -20°C
Manufactured in: United Kingdom
Material Safety Data Sheet (MSDS)

GIP (1-42)-[C] human

GIP (1-42)-[C] human 0.1mg

0.1mg
Bulk Quote