Exendin-4 Heavy

HGEGTFTSD-[U-13C6,15N-Leu]-SKQMEEEAVR-[U-13C6,15N-Leu]-FIEW-[U-13C6,15N-Leu]-KNGGPSSGAPPPS-amide

  • Description

  • Application Data

Description

Exendin-4 is an incretin mimetic that stimulates insulin secretion, an analogue of GLP-1 but resistant to cleavage by plasma DPP-IV.

See full description

Application Data

Catalogue number crb1301695
Molecular Weight 4205.1
Sequence (one letter code)

HGEGTFTSD-[U-13C6,15N-Leu]-SKQMEEEAVR-[U-13C6,15N-Leu]-FIEW-[U-13C6,15N-Leu]-KNGGPSSGAPPPS-amide

Sequence (three letter code)

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-[U-13C6,15N-Leu]-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-[U-13C6,15N-Leu]-Phe-Ile-Glu-Trp-[U-13C6,15N-Leu]-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂

Purity >95%
Storage -20°C
Manufactured in: United Kingdom
Data Sheet Material Safety Data Sheet (MSDS)

Originally identified in Gila monster lizard (Heloderma suspectum), exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.

Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinni cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.

The leucine residues at positions 10, 21, and 26 of this peptide are isotopically labelled with carbon-13 and nitrogen-15, giving this peptide a mass increase of 18.5 compared to the unlabelled peptide

Exendin-4 Heavy

Cat No.Pack SizePriceQty.
25nmol£520.00
Bulk Quote

You may also like…

  • Exendin-4 [Lys(AF647)]

    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-[K(AF647 DBCO)]-amide

    View products
  • [Cys(Cyanine3)]-Exendin 4

    [Cys(Cyanine3)]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide

    View products