Exendin 4 (4–39)

GTFTSDLSKQMEEEAVRLFIE-W-LKNGGPSSGAPPPS-amide

  • Description

  • Application Data

Description

Amino acids 4-39 of exendin-4, a cleavage-resistant analogue of GLP-1 that stimulates insulin release.

See full description

Application Data

Catalogue number crb1000423
Molecular Weight 3860.9
Sequence (one letter code)

GTFTSDLSKQMEEEAVRLFIE-W-LKNGGPSSGAPPPS-amide

Sequence (three letter code)

H-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Purity >95%
References

Kolterman et al., (2005). Pharmacokinetics, pharmacodynamics, and safety of exenatide in patients with type 2 diabetes mellitus. Am. J. Health Syst. Pharm., 62: 173. PMID: 15700891.

Liao et al., (2015). In Vitro Metabolic Stability of Exendin-4: Pharmacokinetics and Identification of Cleavage Products. PLOS ONE, 10(2): e0116805. PMID: 25723538. 

Manufactured in: United Kingdom
Data Sheet Material Safety Data Sheet (MSDS)

This is a truncated exendin-4 peptide, the original peptide was identified in Gila monster lizard (Heloderma suspectum). Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.

Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.

Exendin 4 (4–39)

Cat No.Pack SizePriceQty.
0.5mg£190.00
1mg£260.00
Bulk Quote

Download Family PDF

You may also like…

  • GLP-1 (9-36) amide

    EGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • Oxyntomodulin Heavy

    HSQGTFTSDYSKY-[U-13C6,15N-Leu]-DSRRAQD-[U-13C9,15N-Phe]-VQW-[U-13C6,15N-Leu]-MNTKRNRNNIA-acid

    View products
  • [Biotin]-GLP-1

    [Biotin]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIA-W-LVKGR-amide

    View products
  • GLP-1 (7-36) [Cys(Sulfocyanine5)]

    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide

    View products
  • Glucagon like-peptide-2 (GLP-2)

    DGSFSDEMNTILDNLAARDFINWLIQTKITD-acid

    View products
  • Teduglutide (GLP2 2G)

    HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-acid

    View products
  • Liraglutide

    HAEGTFTSDVSSYLEGQAA-[Lys([Palm]-[g-Glu]-)]-EFIAWLVRGRG-acid

    View products
  • [5-FAM]-GLP-1 (7-36)

    [5-FAM]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • [Cys(Cyanine3)]-Exendin 4

    [Cys(Cyanine3)]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide

    View products
  • [5-FAM]-GLP-1

    [5-FAM]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • [Cys]-Exendin 4

    [C]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide

    View products
  • Biotin-GLP-1 (7-36)

    [Biotin]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • Exendin-4 [Lys(AF647)]

    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-[K(AF647 DBCO)]-amide

    View products