Exendin 4 1mg HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

£220.00
  • Description

  • Application Data

Description

Exendin-4 is a 39-mer peptide, originally isolated from the venom of gila monster (Heloderma suspectum). The peptide binds to the GLP-1 receptor and acts as a potent GLP-1 (7-36) amide agonist. Differs from exendin-3 by only 2 N-terminal amino acid substitutions.

See full description

Application Data

Catalogue number crb1000146j
Molecular Weight 4186.63
Sequence (one letter code) HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Sequence (three letter code)

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂

Purity >95%
Storage This material should be stored below 0 degrees C
References

Fehmann et al. (1994) Peptides 15, 453.

Material Safety Data Sheet (MSDS)

Exendin-4 is a 39-mer peptide, originally isolated from the venom of gila monster (Heloderma suspectum). The peptide binds to the GLP-1 receptor and acts as a potent GLP-1 (7-36) amide agonist. Differs from exendin-3 by only 2 N-terminal amino acid substitutions.

Exendin 4 1mg

1mg
Bulk Quote