Exendin 3

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

  • Description

  • Application Data

Description

Exendin 3 is a potent and selective glucagon-like peptide-1 receptor (GLP-1R) antagonist.

See full description

Application Data

Catalogue number crb1000147
Molecular Weight 4202.63
Sequence (one letter code)

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

Sequence (three letter code)

H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂

Purity >95%
cas 130357-25-4
Storage This material should be stored below 0 degrees C
References

Raufman et al., (1991). Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J.Biol.Chem., 266: 2897. PMID: 1704369.

 

Turton et al., (1996). A role for glucagon-like peptide-1 in the central regulation of feeding. Nature, 379: 69. PMID: 8538742. 

Material Safety Data Sheet (MSDS)

Originally identified in Heloderma horridum horridum (Mexican beaded lizard), exendin-3 is in the glucagon family. Exendin 3 stimulates vasoactive intestinal peptide (VIP) receptors in high concentrations. This leads to increased cAMP levels and amylase secretion in the pancreas. However, low exendin-3 exposure only increases cAMP levels.

In applications, exendin-3 was found to induce hypotension by relaxation of cardiac, smooth muscle. Using a tag, exendin-3 is being investigated as a stable agonist for GLP1R to detect insulinomas, a pancreatic B cell-derived cancer with high GLP1R expression. Exendin 3 has also been used on mouse models to assess its effect on glucose-stimulated insulin secretion in glucagon receptor knockout (Gcgr-/-) backgrounds. Understanding the interplay between exendin 3 and metabolism could provide new insights into the obesity crisis.

Exendin 3

Cat No.Pack SizePriceQty.
1mg£220.00
0.5mg£110.00
Bulk Quote

Download Family PDF

You may also like…