Exendin 3 HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

  • Description

  • Application Data

Description

Exendin 3 is a potent and selective glucagon-like peptide-1 receptor (GLP-1R) antagonist.

See full description

Application Data

Catalogue number crb1000147
Molecular Weight 4202.63
Sequence (one letter code) HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Sequence (three letter code) H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂
Molecular Weight 4202.63
Purity >95%
Storage This material should be stored below 0 degrees C
References

Berclaz et al (2015) Combined Optical Coherence and Fluorescence Microscopy to assess dynamics and specificity of pancreatic beta-cell tracers. Sci. Rep. 5(1) PMID: 25988507

Material Safety Data Sheet (MSDS)

Originally identified in Heloderma horridum horridum (Mexican beaded lizard), exendin-3 stimulates vasoactive intestinal peptide (VIP) receptors in high concentrations. This leads to an increase in cAMP levels and amylase secretion in the pancreas. However, low exendin-3 exposure only increases cAMP levels.

In applications, exendin-3 was found to induce hypotension by relaxation of cardiac smooth muscle. Using a tag, exendin-3 is being investigated as a stable agonist for GLP1R for detection of insulinomas, a pancreatic B cell derived cancer with high GLP1R expression.

Exendin 3

Cat No.Pack SizePriceQty.
1mg£220.00
0.5mg£110.00
Bulk Quote