Exendin 3 0.5mg HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Description
Application Data
Description
-
Exendin-3 is a 39-mer peptide, originally isolated from the venom of the Guatemalan beaded lizard (Heloderma horridum). The peptide binds to the GLP-1 receptor and acts as a potent GLP-1 (7-36) amide
Application Data
-
Catalogue number crb1000147h Molecular Weight 4202.63 Sequence (one letter code) HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂ Sequence (three letter code) H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ Molecular Weight 4202.63 Purity >95% Storage This material should be stored below 0 degrees C References Raufman et al (1991) Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J.Biol.Chem. 266 2897. PMID: 1704369. Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting β-cells. J.Biol.Chem. 268 19650. PMID: 8396143. Thorens et al (1993) Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor. Diabetes 42 1678. PMID: 8405712. Turton et al (1996) A role for glucagon-like peptide-1 in the central regulation of feeding. Nature 379 69. PMID: 8538742. Exendin-3 is a 39-mer peptide, originally isolated from the venom of the Guatemalan beaded lizard (Heloderma horridum). The peptide binds to the GLP-1 receptor and acts as a potent GLP-1 (7-36) amide