[5-FAM]-GLP-1

[5-FAM]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

  • Description

  • Application Data

Description

Glucagon-like peptide (GLP)-1 is a gastrointestinal peptide hormone with a role in insulin secretion, and contains N-terminal fluorescent tag 5-Carboxyfluorescein (5-FAM).

See full description

Application Data

Catalogue number crb1100880
Molecular Weight 4467.1
Sequence (one letter code)

[5-FAM]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

Sequence (three letter code)

[5-FAM]-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Purity >95%
Storage -20°C
References

Graaf et al (2016) Glucagon-Like Peptide-1 and Its Class B G Protein-Coupled Receptors: A Long March to Therapeutic Successes. Pharmacol. Rev. 68(4) 954 PMID: 27630114

Manandhar and Ahn (2014) Glucagon-like Peptide-1 (GLP-1) Analogs: Recent Advances, New Possibilities, and Therapeutic Implications. J. Med. Chem. 58(3) 1020 PMID: 25349901

Manufactured in: United Kingdom
Data Sheet Material Safety Data Sheet (MSDS)

Glucagon-like peptide (GLP)-1 is a gastrointestinal peptide hormone with multiple roles in relation to metabolism. The primary role of GLP-1 is increasing insulin secretion in the presence of high plasma glucose levels, in addition, GLP-1 also suppresses glucagon secretion from the pancreas. GLP-1 slows down gastric emptying and regulates appetite, both valuable in reducing food intake and body weight. These roles of GLP-1 make it a useful target in the management of type 2 diabetes mellitus (T2DM).

GLP-1 exerts its effects by binding to and activating the class B G protein–coupled receptor (GPCR):  GLP-1 receptor (GLP-1R). Receptor activation in turn activates signalling pathways which culminates in insulin secretion via CAMP and Ca2+ signalling.

Recently evidence has increased for GLP-1 playing a cardio-protective role as well as regulating immune responses and even in kidney function. GLP-1 may also exert neuroprotective and neurotropic effects as it can decrease endogenous levels of amyloid-beta (Aβ) and prevent Aβ-induced cell death.

This peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

.

[5-FAM]-GLP-1

Cat No.Pack SizePriceQty.
1mg£300.00
0.5mg£260.00
0.1mg£190.00
Bulk Quote

Download Family PDF

You may also like…

  • Teduglutide (GLP2 2G)

    HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-acid

    View products
  • Biotin-GLP-1 (7-36)

    [Biotin]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • Exendin 3

    HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

    View products
  • Oxyntomodulin Heavy

    HSQGTFTSDYSKY-[U-13C6,15N-Leu]-DSRRAQD-[U-13C9,15N-Phe]-VQW-[U-13C6,15N-Leu]-MNTKRNRNNIA-acid

    View products
  • GLP-1 (9-36) amide

    EGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • [Cys(Cyanine3)]-Exendin 4

    [Cys(Cyanine3)]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide

    View products
  • Glucagon like-peptide-2 (GLP-2)

    DGSFSDEMNTILDNLAARDFINWLIQTKITD-acid

    View products
  • GLP-1 (7-36) [Cys(Sulfocyanine5)]

    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide

    View products
  • Exendin 4 (4–39)

    GTFTSDLSKQMEEEAVRLFIE-W-LKNGGPSSGAPPPS-amide

    View products
  • Exendin 3 (9-39) amide

    DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide

    View products
  • Exendin 4

    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

    View products
  • [Cys]-Exendin 4

    [C]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide

    View products
  • [5-FAM]-GLP-1 (7-36)

    [5-FAM]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide

    View products
  • [Biotin]-GLP-1

    [Biotin]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIA-W-LVKGR-amide

    View products