[5-FAM]-GLP-1
[5-FAM]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
Description
Application Data
Description
-
Glucagon-like peptide (GLP)-1 is a gastrointestinal peptide hormone with a role in insulin secretion, and contains N-terminal fluorescent tag 5-Carboxyfluorescein (5-FAM).
Application Data
-
Catalogue number crb1100880 Molecular Weight 4467.1 Sequence (one letter code) [5-FAM]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
Sequence (three letter code) [5-FAM]-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Purity >95% Storage -20°C References Graaf et al (2016) Glucagon-Like Peptide-1 and Its Class B G Protein-Coupled Receptors: A Long March to Therapeutic Successes. Pharmacol. Rev. 68(4) 954 PMID: 27630114
Manandhar and Ahn (2014) Glucagon-like Peptide-1 (GLP-1) Analogs: Recent Advances, New Possibilities, and Therapeutic Implications. J. Med. Chem. 58(3) 1020 PMID: 25349901
Manufactured in: United Kingdom Glucagon-like peptide (GLP)-1 is a gastrointestinal peptide hormone with multiple roles in relation to metabolism. The primary role of GLP-1 is increasing insulin secretion in the presence of high plasma glucose levels, in addition, GLP-1 also suppresses glucagon secretion from the pancreas. GLP-1 slows down gastric emptying and regulates appetite, both valuable in reducing food intake and body weight. These roles of GLP-1 make it a useful target in the management of type 2 diabetes mellitus (T2DM).
GLP-1 exerts its effects by binding to and activating the class B G protein–coupled receptor (GPCR): GLP-1 receptor (GLP-1R). Receptor activation in turn activates signalling pathways which culminates in insulin secretion via CAMP and Ca2+ signalling.
Recently evidence has increased for GLP-1 playing a cardio-protective role as well as regulating immune responses and even in kidney function. GLP-1 may also exert neuroprotective and neurotropic effects as it can decrease endogenous levels of amyloid-beta (Aβ) and prevent Aβ-induced cell death.
This peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
.
You may also like…
-
Teduglutide (GLP2 2G)
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-acid
View products -
Biotin-GLP-1 (7-36)
[Biotin]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products -
Exendin 3
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
View products -
Oxyntomodulin Heavy
HSQGTFTSDYSKY-[U-13C6,15N-Leu]-DSRRAQD-[U-13C9,15N-Phe]-VQW-[U-13C6,15N-Leu]-MNTKRNRNNIA-acid
View products -
GLP-1 (9-36) amide
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products -
[Cys(Cyanine3)]-Exendin 4
[Cys(Cyanine3)]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide
View products -
Glucagon like-peptide-2 (GLP-2)
DGSFSDEMNTILDNLAARDFINWLIQTKITD-acid
View products -
GLP-1 (7-36) [Cys(Sulfocyanine5)]
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide
View products -
Exendin 4 (4–39)
GTFTSDLSKQMEEEAVRLFIE-W-LKNGGPSSGAPPPS-amide
View products -
Exendin 3 (9-39) amide
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide
View products -
Exendin 4
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
View products -
[Cys]-Exendin 4
[C]-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide
View products -
[5-FAM]-GLP-1 (7-36)
[5-FAM]-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-amide
View products -
[Biotin]-GLP-1
[Biotin]-HDEFERHAEGTFTSDVSSYLEGQAAKEFIA-W-LVKGR-amide
View products